PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.2021s0010.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 246aa    MW: 27963.3 Da    PI: 5.8076
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.2021s0010.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM94.51.7e-2957754128
                     NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +      g+kk Lvfy g+apkg kt+W+mheyrl
  SapurV1A.2021s0010.2.p   5 GEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGR--PGPLGIKKALVFYAGKAPKGIKTNWIMHEYRL 77 
                             579************************************98..668***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.4461103IPR003441NAC domain
SuperFamilySSF1019413.27E-363103IPR003441NAC domain
PfamPF023654.6E-14977IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MALYGEKEWY FFSPRDRKYP NGSRPNRAAG TGYWKATGAD KPIGRPGPLG IKKALVFYAG  60
KAPKGIKTNW IMHEYRLANV DRSAGKKNNL RLDDWVLCRI YNKKGSVEKH FPSERKSTAS  120
YPEMEDRKPD INEISGYQNG MSQVAAAAMV MSDASEFLQM DTSDSIPRLN TDSSSSEHVL  180
SPEVTCDKEV QSQQKWNEQL DNAFDFNFDY ADDGFQDDPF ASQIQFQMDQ LSPLQDMFMY  240
LQKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-49210966171NAC domain-containing protein 19
4dul_A1e-49210966171NAC domain-containing protein 19
1ut7_B1e-49210966171NO APICAL MERISTEM PROTEIN
1ut7_A1e-49210966171NO APICAL MERISTEM PROTEIN
1ut4_B1e-49210966171NO APICAL MERISTEM PROTEIN
1ut4_A1e-49210966171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2237841e-137CU223784.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002309945.11e-165hypothetical protein POPTR_0007s04780g
SwissprotQ390135e-90NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB9HF581e-165B9HF58_POPTR; Uncharacterized protein
STRINGPOPTR_0007s04780.11e-164(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-83NAC family protein